Verified memberOpen to offersChat enabled

firstclasscarvaleting.co.uk

Visit
SEO stats
RQS 4,757UV 160DA 1PA 16TF 0CF 3Refs 8Backlinks 9
30-day visits 4,753 Peak 1,575 on 29/08
19 Aug 2026: 3 hits20 Aug 2026: 17 hits21 Aug 2026: 22 hits22 Aug 2026: 43 hits23 Aug 2026: 6 hits24 Aug 2026: 1,537 hits25 Aug 2026: 8 hits26 Aug 2026: 3 hits27 Aug 2026: 2 hits28 Aug 2026: 251 hits29 Aug 2026: 1,575 hits30 Aug 2026: 1,020 hits31 Aug 2026: 0 hits1 Sep 2026: 6 hits2 Sep 2026: 2 hits3 Sep 2026: 11 hits4 Sep 2026: 3 hits5 Sep 2026: 1 hit6 Sep 2026: 112 hits7 Sep 2026: 1 hit8 Sep 2026: 23 hits9 Sep 2026: 6 hits10 Sep 2026: 23 hits11 Sep 2026: 25 hits12 Sep 2026: 3 hits13 Sep 2026: 22 hits14 Sep 2026: 9 hits15 Sep 2026: 12 hits16 Sep 2026: 7 hits17 Sep 2026: 0 hits
Last 30 days19 Aug - 17 Sep 2026

About firstclasscarvaleting.co.uk

Why it stands out

21 characters
1-word domain
No hyphens or numbers.
Clear buyer intent

Potential uses

Firstclasscarvaleting marketplacefirstclasscarvaleting directoryautomotive lead generationspecialist content site.

Domain facts

Platform: Domain LanderCategory: Automotive
Listed: 29 Jul 2026Registered: Unavailable
Extension: .co.ukDomain length: 21 characters
Word count: 1-word domainHyphens and numbers: No hyphens or numbers.
View Whois: Click here to view firstclasscarvaleting.co.uk whoisPrimary keywords: Firstclasscarvaleting
0 DomainUI members like this domain.0 DomainUI members would pass on this domain.
Current Price No Buy Now price

Sign in or create a free account to contact the seller, make offers and save domains.

What's included

firstclasscarvaleting.co.uk domain name

Domain only unless the seller agrees otherwise.

Buyer confidence

Ownership verified

Terms confirmed before payment

Guided transfer process

How buying works

  1. 1
    Agree the price

    Buy now or make an offer. Agree terms with the seller.

  2. 2
    Confirm secure payment

    Complete payment using the agreed safe payment method.

  3. 3
    Receive the domain

    Once payment is confirmed, the domain transfer can be started.